99.71% median purity by HPLC across 39 lab testsFree express shipping on orders over $200 · 1–2 business days

Cart Account
Sale!
NuVion LL-37 research peptide vial

LL-37

Original price was: A$79.00.Current price is: A$59.00.

LL-37, a human cathelicidin peptide studied in host defence and tissue repair.

Research use only. Not for human or veterinary use.

In stock

All prices are in AUD. Ships from Australia with tracked express shipping, $15 flat, 1 to 2 business days, free on orders over $200. Research use only, not for human or veterinary use.

  • Testing status on this page
  • Same-day dispatch before 2pm
  • Dispatched from Australia
  • Card, Apple Pay & Google Pay

Research use only

Not for human or veterinary use.

Laboratory chemical

Supplied for in vitro research. We publish specifications and handling guidance only, with no protocols and no advice on use.

Not on the ARTG

Absent from the Australian Register of Therapeutic Goods and never evaluated by the TGA for safety, quality or efficacy. Absence from the register is not an approval and does not authorise any other use.

Who can order

You must be 18 or over and purchasing solely for lawful research.

What is LL-37?

LL-37 is the human cathelicidin-derived 37 amino acid antimicrobial peptide. It is used in bacterial culture and keratinocyte models to study membrane permeabilisation, chemotaxis and innate immune defence, and NuVion stocks it in Australia as a 5mg lyophilised vial.

  • Human cathelicidin-derived 37 amino acid antimicrobial peptide
  • Used in bacterial culture and keratinocyte models
  • Applied in membrane permeabilisation and chemotaxis assays
  • Supplied lyophilised, purity by RP-HPLC and identity by mass spectrometry

LL-37 structure and research use

LL-37 is the only cathelicidin found in humans. It is cut from the C-terminal end of the precursor protein hCAP18, which is encoded by the CAMP gene, and takes its name from its 37 amino acids and the two leucines it starts with. In solution it folds into an amphipathic alpha helix. In the laboratory it is used in bacterial culture and keratinocyte models for work on membrane permeabilisation and chemotaxis.

LL-37 research applications

  • Broth microdilution for minimum inhibitory concentration against reference bacterial strains, with low-salt and high-salt media in parallel
  • SYTOX Green or propidium iodide uptake and calcein leakage from phosphatidylglycerol liposomes as membrane permeabilisation readouts
  • Circular dichroism in SDS micelles or trifluoroethanol to follow folding of the amphipathic helix
  • FPR2 signalling in HEK293-FPR2 or differentiated HL-60 cells using calcium flux, transwell chemotaxis and antagonist controls

LL-37 key facts

Type Synthetic peptide, human cathelicidin fragment, cationic antimicrobial peptide
Amino acid count 37
Sequence [LL-37, 37 aa]
Also known as Cathelicidin LL-37, hCAP18 C-terminal peptide, CAMP antimicrobial peptide
Vial size 5mg, lyophilised
Purity 99.85% by RP-HPLC, Janoshik Analytical
Analysed 18 March 2026

NuVion also sells LL-37 in the Immune Signalling Pair, with each compound in its own vial.

Research profile: LL-37: structure, mechanism and research use

Independent test: a sample of this product was analysed by Janoshik Analytical on 18 March 2026, purity 99.85% by RP-HPLC. The certificate is shown in the lab band on this page.

Why buy LL-37 from NuVion

Testing status on every page

Published results show the measured purity, the date and the certificate.

Australian stock, domestic post

Held in Australia and sent tracked in plain outer packaging.

Specifications

Chemical structure of LL-37 Janoshik test report, LL-37, purity 99.850%
Sequence Length 37
CAS Number 154947-66-7
Molecular Weight 4493
Molecular Formula C205H340N60O53

Storing and handling LL-37

Before reconstitution
Keep the sealed vial cool, dry and out of direct light. General practice for lyophilised peptides.
After reconstitution
Reconstitute with bacteriostatic or sterile water, store at 2 to 8°C and avoid repeated freeze-thaw cycles. No stability-tested shelf life is published for this product.

Reconstitution and storage Volumes, concentrations and storage at a glance.

LL-37 questions

Where can I buy LL-37 in Australia?
NuVion stocks LL-37 in Australia as a 5mg vial of lyophilised powder, posted from Australian stock on a tracked express service. A sample was analysed by Janoshik Analytical on 18 March 2026, with purity of 99.85% by RP-HPLC. It also comes in the Immune Signalling Pair. Bacteriostatic water is sold separately. LL-37 is supplied as a research material only and is not on the Australian Register of Therapeutic Goods.
What is LL-37 used for in research?
It is the standard human cathelicidin reference peptide. Microbiology groups use it for MIC, membrane permeabilisation and biofilm assays, biophysics groups use it as a model amphipathic helix for lipid bilayer studies, and cell biology groups use it as an FPR2 agonist and EGFR transactivator in migration and signalling assays.
How does LL-37 work at the cell level?
The primary target of LL-37 is the microbial membrane. Electrostatic attraction to anionic headgroups (phosphatidylglycerol, cardiolipin, lipid A of lipopolysaccharide, lipoteichoic acid) concentrates the peptide at the bilayer surface, where it folds into the amphipathic helix and inserts its hydrophobic face into the acyl chain region. The LL-37 research profile covers the mechanism in full.
What is the net charge of LL-37 at neutral pH?
The net charge is about +6. LL-37 carries five arginines and six lysines against two aspartates and three glutamates, once the termini are counted. The basic residues line one face of the helix and the hydrophobic residues line the other.
When does LL-37 fold into its helix?
LL-37 folds as salt concentration rises or when it meets anionic lipid, detergent micelles or trifluoroethanol. In water at low ionic strength it is largely unstructured. The helix runs from roughly residue 2 to 31, and the C-terminal tail stays flexible.
What are KR-12 and D-LL-37?
They are related peptides often run beside LL-37. KR-12 is residues 18 to 29, the smallest fragment that keeps measurable antibacterial activity. D-LL-37 is the all-D enantiomer, used to separate chiral, receptor-dependent responses from achiral membrane effects.
Why is it called LL-37?
Its sequence starts with two leucines, written LL in one-letter amino acid code, and it is 37 amino acids long.

Shipping, returns and wholesale orders are covered in the FAQs.

Related research peptides

NuVion Selank research peptide vial

Selank

10mg

Original price was: A$69.00.Current price is: A$59.00.

Add to cart
NuVion 5-Amino-1MQ research vial

5-Amino-1MQ

10mg

Original price was: A$69.00.Current price is: A$59.00.

Add to cart
NuVion IGF-1 LR3 research peptide vial

IGF-1 LR3

1mg

A$159.00

Read more
NuVion TB-500 research peptide vial

TB-500

10mg

A$99.00

Read more